PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011089262.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TALE
Protein Properties Length: 806aa    MW: 88418.3 Da    PI: 7.0875
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011089262.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-096316632254
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     ++yp+ +++  LA+++gLt +qV++WF N R +
  XP_011089262.1 631 HPYPTDTDKHMLAAQTGLTRNQVSNWFINARVR 663
                     89*****************************88 PP

2BELL104.19.7e-34484551471
            BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                     e+ +kkakL+ +l+eV+krYkqy++q+q+v+ssFe vagl +a+pY+slAlk +S+hFrcLk aia+ 
  XP_011089262.1 484 ENLQKKAKLMYMLDEVCKRYKQYQQQMQMVVSSFESVAGLSAATPYVSLALKMVSKHFRCLKSAIADS 551
                     7789*************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.2E-42391550IPR006563POX domain
PfamPF075266.5E-41396549IPR006563POX domain
PROSITE profilePS5007111.823604667IPR001356Homeobox domain
SMARTSM003891.6E-9607671IPR001356Homeobox domain
CDDcd000861.64E-12607668No hitNo description
SuperFamilySSF466894.71E-17609673IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-28610671IPR009057Homeodomain-like
PfamPF059204.1E-18624663IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 806 aa     Download sequence    Send to blast
MDMSNFRPEL HVAQQSRRDK LRIQHDSNPP HYQVYPNNLQ QLPPHDALNY ESNNLRNCRP  60
GNICYDSSDF CSEMPNFSMN SQGMLAQKDA VMVHQEPDKR VGETFFGSLS RTIPNTFNPS  120
ATISSDPQYF TTWKSIGSQS SSDWVANQTP IFVGEGLSGS SLRIINSCTP ISTFEVKPYL  180
GYQELHPPLN NPATEVSNPS SQNKHYGDMH CSSSLYQNAF QELVAAPNDR SSGVELRQKG  240
SEETSHGPWV VGGGELLLLP AYADQLRLKS VSQSVNRPAD GCNQWSGELD YAAAKNADNS  300
NNQTLSLSLS SVPSPKVHAT HIADRDIAMD LHCTDVCAGG NVQGSRTLKP ENLLSDPNLL  360
TGGKVLGNVR ADMMAIPALT HRNPGPLGPF TGYATILRSS KYLRPAQQLL DELCIVARPK  420
HIEICEGPHK ILEEVRVSSD AVSNAEVPAV TGDSSGSSFV FNASNDKGRE PEGASCSTDS  480
YRPENLQKKA KLMYMLDEVC KRYKQYQQQM QMVVSSFESV AGLSAATPYV SLALKMVSKH  540
FRCLKSAIAD SLKGIINALG EDLSSPTAGT STSKSDAGVS MLKFFDQSFQ RQKGAAGLGI  600
LEGQHIWRPQ RGLPERAVSI LRAWLFDHFL HPYPTDTDKH MLAAQTGLTR NQVSNWFINA  660
RVRLWKPMVE EIHMLETKGL AAETGSDAGK TNGMKVAIEG CDQANKQQVE CSSISPSGRE  720
IDRLNANTWN QEKRSRIEYH VPSSVDGSLM GLVPSHRSGV EFGGLGAVSL TLGLRQSAEN  780
AQRPSLQQEH HLRPHFGGHI IRDFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A2e-16613671563Homeobox protein Meis2
4xrm_B2e-16613671563Homeobox protein Meis2
4xrs_A2e-16613670158Homeobox protein Meis1
4xrs_B2e-16613670158Homeobox protein Meis1
5bng_A2e-16613671159Homeobox protein Meis2
5bng_B2e-16613671159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089262.10.0PREDICTED: uncharacterized protein LOC105170277
TrEMBLA0A068UHG50.0A0A068UHG5_COFCA; Uncharacterized protein
STRINGVIT_06s0004g02580.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87202227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.11e-76BEL1-like homeodomain 8